HORDB

ID: hor003924
Uniprot ID: Q9YGK2
Protein name: Lipotropin beta
Gene name: pomc
Organism: Thunnus obesus (Bigeye tuna)
Family: POMC family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Thunnus (genus), Thunnini (tribe), Scombrinae (subfamily), Scombridae (family), Scombriformes (order), Pelagiaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007218 neuropeptide signaling pathway
GO CC: GO:0005576 extracellular region

Sequence: ELASELLAAAEEEEEKAQEVMAEEEEEQKQLLQEKKDGSYKMKHFRWSGPPASKRYGGFMKSWDERSQRPLLTLFKNVINKDGQQQK
Length: 87
Propeptide: MCPVWLLVAVVVVGGSRGAVSQCWEHPSCQELNSDSSMMECIQLCHSDLTAEKPVIPGNAHLQPPPLPDPSSSSSFILPSSSSSSSSPQSKRSYSMEHFRWGKPVGRKRRPVKVYTSNGVEEESAEVFPGEMRRRELASELLAAAEEEEEKAQEVMAEEEEEQKQLLQEKKDGSYKMKHFRWSGPPASKRYGGFMKSWDERSQRPLLTLFKNVINKDGQQQK
Signal peptide: MCPVWLLVAVVVVGGSRG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: [Corticotropin]: Stimulates the adrenal glands to release cortisol.; [Melanocyte-stimulating hormone alpha]: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Melanocyte-stimulating hormone beta]: Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Beta-endorphin]: Endogenous orexigenic opiate.; [Met-enkephalin]: Endogenous opiate.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor003924_AF2.pdb

hor003924_ESM.pdb

Mass:	1170753	Formula:	C445H702N124O143S3
Absent amino acids:	C	Common amino acids:	E
pI:	4.98	Basic residues:	16
Polar residues:	16	Hydrophobic residues:	23
Hydrophobicity:	-125.06	Boman Index:	-24417
Half-Life:	1 hour	Half-Life Yeast:	30 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	55.06
Instability Index:	8839.43	Extinction Coefficient cystines:	13980
Absorbance 280nm:	162.56